PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_024896
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 142aa    MW: 16052 Da    PI: 8.9007
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_024896genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.55.8e-4156132177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqv++C a++s ak yhrrhkvCe+h+kapvv++sg++qrfCqqCsrfhel efD++krsCrrrL +hnerrrk++
  DCAR_024896  56 CCQVQDCLANMSIAKAYHRRHKVCEFHAKAPVVVISGVQQRFCQQCSRFHELPEFDDAKRSCRRRLLGHNERRRKSS 132
                  6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375758.8E-571141IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.8E-3449118IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.65854131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.8E-3855135IPR004333Transcription factor, SBP-box
PfamPF031101.3E-3257130IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MDIGKAEGKR SVRDRMKADV VKEDEEDEDA EEDNKKKRVM TYSGRKGSGG GSTQPCCQVQ  60
DCLANMSIAK AYHRRHKVCE FHAKAPVVVI SGVQQRFCQQ CSRFHELPEF DDAKRSCRRR  120
LLGHNERRRK SSYDFPGEGS G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3647130184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306237.17e-58SQUAMOSA promoter binding protein-like
RefseqXP_015063347.17e-58PREDICTED: squamosa promoter-binding protein 1 isoform X1
RefseqXP_015063348.17e-58PREDICTED: squamosa promoter-binding protein 1 isoform X1
SwissprotQ387411e-55SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLQ0PY358e-58Q0PY35_SOLLC; Squamosa promoter-binding-like protein
STRINGSolyc02g077920.2.12e-57(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-31squamosa promoter binding protein-like 3